PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1942_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25752.3 Da    PI: 9.9757
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1942_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.52e-29959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien +nrqvt+skRrngi+KKA+EL vLCda+v++i+fs+tgk++ey+s
  Neem_1942_f_1  9 KRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYIS 59
                   79***********************************************86 PP

2K-box92.11e-3071164194
          K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                    yqk+ g++l++++++++q+ ++kLk+ +++L++ +R+++GedL++L ++eL+ Leq++  +++++R++K++++++q+++ +kk ++l+e++ ++
  Neem_1942_f_1  71 YQKTLGVDLWSTHYAKMQETYRKLKEINNKLRKDIRQRMGEDLDDLGIEELRGLEQKMTAAVTNVRERKYHVIKTQTDTYKKKVRNLEERHGNI 164
                    7899999**********************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.548161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-37295IPR002100Transcription factor, MADS-box
CDDcd002651.76E-41280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-2182164IPR002487Transcription factor, K-box
PROSITE profilePS5129714.8784174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIEIKR IENPTNRQVT YSKRRNGIFK KAQELTVLCD AKVSLIMFSN TGKFHEYISP  60
TTSTKKMFDQ YQKTLGVDLW STHYAKMQET YRKLKEINNK LRKDIRQRMG EDLDDLGIEE  120
LRGLEQKMTA AVTNVRERKY HVIKTQTDTY KKKVRNLEER HGNILLDFET RYDDPHFGLV  180
DNGDYQSAVA LANGASNLYA FRMQQANLQQ TAGVFGSGDL TLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-14159159Myocyte-specific enhancer factor 2B
1tqe_Q1e-14159159Myocyte-specific enhancer factor 2B
1tqe_R1e-14159159Myocyte-specific enhancer factor 2B
1tqe_S1e-14159159Myocyte-specific enhancer factor 2B
3mu6_A9e-15259158Myocyte-specific enhancer factor 2A
3mu6_B9e-15259158Myocyte-specific enhancer factor 2A
3mu6_C9e-15259158Myocyte-specific enhancer factor 2A
3mu6_D9e-15259158Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425563.11e-150hypothetical protein CICLE_v10026433mg
RefseqXP_006466888.11e-150PREDICTED: floral homeotic protein DEFICIENS-like
SwissprotP237065e-97DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A067FUM11e-151A0A067FUM1_CITSI; Uncharacterized protein
STRINGVIT_04s0023g02820.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52612750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-78MIKC_MADS family protein